SH3BGR Antikörper (N-Term)

Produktnummer ABIN630536

Produktdetails anti-SH3BGR Antikörper

Target: SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3BGR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SH3 BGR antibody was raised against the N terminal of SH3 GR

Aufreinigung: Affinity purified

Immunogen: SH3 BGR antibody was raised using the N terminal of SH3 GR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3BGR Blocking Peptide, catalog no. 33R-1691, is also available for use as a blocking control in assays to test for specificity of this SH3BGR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3BGR

Target: SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))

Andere Bezeichnung: SH3BGR (SH3BGR Produkte)

Synonyme: 21-garp antikoerper, MGC82574 antikoerper, Sh3bgr antikoerper, ACYPI008600 antikoerper, RGD1563599 antikoerper, 21-GARP antikoerper, 5430437A18Rik antikoerper, SH3 domain binding glutamate-rich protein L homeolog antikoerper, SH3 domain binding glutamic acid-rich protein antikoerper, SH3 domain binding glutamate-rich protein antikoerper, SH3 domain binding glutamate rich protein antikoerper, SH3-binding domain glutamic acid-rich protein antikoerper, sh3bgr.L antikoerper, Sh3bgr antikoerper, SH3BGR antikoerper

Hintergrund: SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.

Molekulargewicht: 26 kDa (MW of target protein)