PRDM15 Antikörper (Middle Region)

Produktnummer ABIN630539

Produktdetails anti-PRDM15 Antikörper

Target: PRDM15 (PR Domain Containing 15 (PRDM15))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRDM15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRDM15 antibody was raised against the middle region of PRDM15

Aufreinigung: Affinity purified

Immunogen: PRDM15 antibody was raised using the middle region of PRDM15 corresponding to a region with amino acids LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRDM15 Blocking Peptide, catalog no. 33R-4819, is also available for use as a blocking control in assays to test for specificity of this PRDM15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDM15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRDM15

Target: PRDM15 (PR Domain Containing 15 (PRDM15))

Andere Bezeichnung: PRDM15 (PRDM15 Produkte)

Synonyme: C21orf83 antikoerper, PFM15 antikoerper, ZNF298 antikoerper, E130018M06Rik antikoerper, ORF62 antikoerper, Zfp298 antikoerper, PR domain containing 15 antikoerper, PR domain zinc finger protein 15 antikoerper, PR/SET domain 15 antikoerper, prdm15 antikoerper, LOC722504 antikoerper, PRDM15 antikoerper, Prdm15 antikoerper

Hintergrund: PRDM15 may be involved in transcriptional regulation.

Molekulargewicht: 134 kDa (MW of target protein)