PWP2 Antikörper

Produktnummer ABIN630541

Produktdetails anti-PWP2 Antikörper

Target: PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PWP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PWP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PWP2 Blocking Peptide, catalog no. 33R-9762, is also available for use as a blocking control in assays to test for specificity of this PWP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PWP2

Target: PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))

Andere Bezeichnung: PWP2 (PWP2H Produkte)

Synonyme: 6530411D08Rik antikoerper, Pwp2h antikoerper, wdp103 antikoerper, EHOC-17 antikoerper, PWP2H antikoerper, UTP1 antikoerper, cb471 antikoerper, zgc:56063 antikoerper, PWP2 periodic tryptophan protein homolog (yeast) antikoerper, PWP2, small subunit processome component antikoerper, Pwp2 antikoerper, PWP2 antikoerper, pwp2h antikoerper

Hintergrund: PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.

Molekulargewicht: 102 kDa (MW of target protein)