PWP2 Antikörper
-
- Target Alle PWP2 (PWP2H) Produkte
- PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PWP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PWP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PWP2 Blocking Peptide, catalog no. 33R-9762, is also available for use as a blocking control in assays to test for specificity of this PWP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))
- Andere Bezeichnung
- PWP2 (PWP2H Produkte)
- Hintergrund
- PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.
- Molekulargewicht
- 102 kDa (MW of target protein)
-