RRP1B Antikörper
-
- Target Alle RRP1B Produkte
- RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RRP1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RRP1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RRP1B Blocking Peptide, catalog no. 33R-9842, is also available for use as a blocking control in assays to test for specificity of this RRP1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))
- Andere Bezeichnung
- RRP1B (RRP1B Produkte)
- Hintergrund
- RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.
- Molekulargewicht
- 84 kDa (MW of target protein)
-