Achaete-scute complex protein T5 (AC) (N-Term) Antikörper

Produktnummer ABIN630551

Produktdetails

Target: Achaete-scute complex protein T5 (AC)

Bindungsspezifität: N-Term

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AC antibody was raised against the N terminal Of Ac

Aufreinigung: Affinity purified

Immunogen: AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AC Blocking Peptide, catalog no. 33R-3003, is also available for use as a blocking control in assays to test for specificity of this AC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Achaete-scute complex protein T5 (AC)

Abstract: AC Produkte

Synonyme: AC antikoerper, ACDase antikoerper, ASAH antikoerper, PHP antikoerper, PHP32 antikoerper, SMAPME antikoerper, N-acylsphingosine amidohydrolase 1 antikoerper, ASAH1 antikoerper

Hintergrund: The function of AC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 23 kDa (MW of target protein)