Achaete-scute complex protein T5 (AC) (N-Term) Antikörper
-
- Target Alle Achaete-scute complex protein T5 (AC) Antikörper anzeigen
- Achaete-scute complex protein T5 (AC)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AC antibody was raised against the N terminal Of Ac
- Aufreinigung
- Affinity purified
- Immunogen
- AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
- Top Product
- Discover our top product AC Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AC Blocking Peptide, catalog no. 33R-3003, is also available for use as a blocking control in assays to test for specificity of this AC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Achaete-scute complex protein T5 (AC)
- Abstract
- AC Produkte
- Hintergrund
- The function of AC protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 23 kDa (MW of target protein)
-