LRRC28 Antikörper (N-Term)

Produktnummer ABIN630553

Produktdetails anti-LRRC28 Antikörper

Target: LRRC28 (Leucine Rich Repeat Containing 28 (LRRC28))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC28 antibody was raised against the N terminal of LRRC28

Aufreinigung: Affinity purified

Immunogen: LRRC28 antibody was raised using the N terminal of LRRC28 corresponding to a region with amino acids KDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC28 Blocking Peptide, catalog no. 33R-4280, is also available for use as a blocking control in assays to test for specificity of this LRRC28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC28

Target: LRRC28 (Leucine Rich Repeat Containing 28 (LRRC28))

Andere Bezeichnung: LRRC28 (LRRC28 Produkte)

Synonyme: MGC69360 antikoerper, 1300004K21Rik antikoerper, 2210012C09Rik antikoerper, 2310058O11Rik antikoerper, leucine rich repeat containing 28 antikoerper, lrrc28 antikoerper, LRRC28 antikoerper, Lrrc28 antikoerper

Hintergrund: LRRC28 contains 11 LRR (leucine-rich) repeats. The function of the LRRC28 protein is not known.

Molekulargewicht: 42 kDa (MW of target protein)