LRRC28 Antikörper (N-Term)
-
- Target Alle LRRC28 Antikörper anzeigen
- LRRC28 (Leucine Rich Repeat Containing 28 (LRRC28))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRC28 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRC28 antibody was raised against the N terminal of LRRC28
- Aufreinigung
- Affinity purified
- Immunogen
- LRRC28 antibody was raised using the N terminal of LRRC28 corresponding to a region with amino acids KDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIG
- Top Product
- Discover our top product LRRC28 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRC28 Blocking Peptide, catalog no. 33R-4280, is also available for use as a blocking control in assays to test for specificity of this LRRC28 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC28 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC28 (Leucine Rich Repeat Containing 28 (LRRC28))
- Andere Bezeichnung
- LRRC28 (LRRC28 Produkte)
- Synonyme
- MGC69360 antikoerper, 1300004K21Rik antikoerper, 2210012C09Rik antikoerper, 2310058O11Rik antikoerper, leucine rich repeat containing 28 antikoerper, lrrc28 antikoerper, LRRC28 antikoerper, Lrrc28 antikoerper
- Hintergrund
- LRRC28 contains 11 LRR (leucine-rich) repeats. The function of the LRRC28 protein is not known.
- Molekulargewicht
- 42 kDa (MW of target protein)
-