CKM Antikörper (Middle Region)
-
- Target Alle CKM Antikörper anzeigen
- CKM (Creatine Kinase, Muscle (CKM))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CKM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CKMM antibody was raised against the middle region of CKM
- Aufreinigung
- Affinity purified
- Immunogen
- CKMM antibody was raised using the middle region of CKM corresponding to a region with amino acids GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI
- Top Product
- Discover our top product CKM Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CKMM Blocking Peptide, catalog no. 33R-3630, is also available for use as a blocking control in assays to test for specificity of this CKMM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).
: "
-
Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).
-
- Target
- CKM (Creatine Kinase, Muscle (CKM))
- Andere Bezeichnung
- CKMM (CKM Produkte)
- Synonyme
- CKMM antikoerper, M-CK antikoerper, Ckmm antikoerper, MCK antikoerper, ckmm antikoerper, m-ck antikoerper, CKM antikoerper, CK-M antikoerper, cb51 antikoerper, ckm antikoerper, mck antikoerper, wu:fa28d05 antikoerper, ckm3 antikoerper, wu:fb55e09 antikoerper, zgc:64204 antikoerper, zgc:92070 antikoerper, creatine kinase, M-type antikoerper, creatine kinase, muscle antikoerper, creatine kinase, M-type L homeolog antikoerper, creatine kinase, muscle a antikoerper, creatine kinase, muscle b antikoerper, CKM antikoerper, Ckm antikoerper, ckm.L antikoerper, ckm antikoerper, ckma antikoerper, ckmb antikoerper
- Hintergrund
- CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.
- Molekulargewicht
- 43 kDa (MW of target protein)
-