IFRD1 Antikörper (N-Term)

Produktnummer ABIN630559

Produktdetails anti-IFRD1 Antikörper

Target: IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFRD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IFRD1 antibody was raised against the N terminal of IFRD1

Aufreinigung: Affinity purified

Immunogen: IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFRD1 Blocking Peptide, catalog no. 33R-9754, is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFRD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFRD1

Target: IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))

Andere Bezeichnung: IFRD1 (IFRD1 Produkte)

Synonyme: im:7067566 antikoerper, si:dkey-192l17.2 antikoerper, wu:fi35f04 antikoerper, wu:fj67a06 antikoerper, zgc:154080 antikoerper, IFR1 antikoerper, PC4 antikoerper, TIS7 antikoerper, Ifnl antikoerper, Tis7 antikoerper, Pc4 antikoerper, interferon-related developmental regulator 1 antikoerper, interferon related developmental regulator 1 L homeolog antikoerper, interferon related developmental regulator 1 antikoerper, ifrd1 antikoerper, ifrd1.L antikoerper, IFRD1 antikoerper, Ifrd1 antikoerper

Hintergrund: IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Molekulargewicht: 50 kDa (MW of target protein)