PLSCR3 Antikörper (Middle Region)
-
- Target Alle PLSCR3 Antikörper anzeigen
- PLSCR3 (phospholipid Scramblase 3 (PLSCR3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLSCR3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLSCR3 antibody was raised against the middle region of PLSCR3
- Aufreinigung
- Affinity purified
- Immunogen
- PLSCR3 antibody was raised using the middle region of PLSCR3 corresponding to a region with amino acids GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV
- Top Product
- Discover our top product PLSCR3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLSCR3 Blocking Peptide, catalog no. 33R-3187, is also available for use as a blocking control in assays to test for specificity of this PLSCR3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLSCR3 (phospholipid Scramblase 3 (PLSCR3))
- Andere Bezeichnung
- PLSCR3 (PLSCR3 Produkte)
- Synonyme
- 2210403O21Rik antikoerper, 2610037N06Rik antikoerper, ESTM3 antikoerper, X83310 antikoerper, Pls3 antikoerper, zgc:77051 antikoerper, phospholipid scramblase 3 antikoerper, phospholipid scramblase 3b antikoerper, PLSCR3 antikoerper, Plscr3 antikoerper, plscr3b antikoerper
- Hintergrund
- PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis
-