RPL30 Antikörper (Middle Region)
-
- Target Alle RPL30 Antikörper anzeigen
- RPL30 (Ribosomal Protein L30 (RPL30))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPL30 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPL30 antibody was raised against the middle region of RPL30
- Aufreinigung
- Affinity purified
- Immunogen
- RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA
- Top Product
- Discover our top product RPL30 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPL30 Blocking Peptide, catalog no. 33R-5092, is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL30 (Ribosomal Protein L30 (RPL30))
- Andere Bezeichnung
- RPL30 (RPL30 Produkte)
- Synonyme
- BcDNA:RE25263 antikoerper, BcDNA:RH09938 antikoerper, CG10652 antikoerper, Dmel\\CG10652 antikoerper, L30 antikoerper, RPL30 antikoerper, Rp L30 antikoerper, Rpl30 antikoerper, anon-EST:fe1D4 antikoerper, l(2)01265 antikoerper, l(2)SH0229 antikoerper, l(2)SH2 0229 antikoerper, l(2)k09918 antikoerper, plume antikoerper, fa93d05 antikoerper, wu:fa93d05 antikoerper, zgc:56640 antikoerper, zgc:77683 antikoerper, Ribosomal protein L30 antikoerper, ribosomal protein L30 antikoerper, ribosomal protein L30E antikoerper, Ribosomal protein L30, component of cytosolic 80S ribosome and 60S large subunit antikoerper, 50S ribosomal protein L30 antikoerper, ribosomal protein L24 antikoerper, ribosomal protein L30 S homeolog antikoerper, 60S ribosomal protein L30 antikoerper, RpL30 antikoerper, RPL30 antikoerper, rpl30 antikoerper, HVO_RS16975 antikoerper, RPL24 antikoerper, Rpl30 antikoerper, rpl30.S antikoerper, LOC101106855 antikoerper
- Hintergrund
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.
- Molekulargewicht
- 13 kDa (MW of target protein)
-