TRIM54 Antikörper (N-Term)

Produktnummer ABIN630592

Produktdetails anti-TRIM54 Antikörper

Target: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM54 antibody was raised against the N terminal of TRIM54

Aufreinigung: Affinity purified

Immunogen: TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM54 Blocking Peptide, catalog no. 33R-6692, is also available for use as a blocking control in assays to test for specificity of this TRIM54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM54

Target: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Andere Bezeichnung: TRIM54 (TRIM54 Produkte)

Synonyme: MGC80214 antikoerper, si:dkey-221h15.2 antikoerper, DKFZp468L1522 antikoerper, MURF antikoerper, MURF-3 antikoerper, RNF30 antikoerper, muRF3 antikoerper, 4930486E09Rik antikoerper, 4930566I02Rik antikoerper, MuRF3 antikoerper, Rnf30 antikoerper, tripartite motif containing 54 antikoerper, tripartite motif containing 54 S homeolog antikoerper, tripartite motif-containing 54 antikoerper, TRIM54 antikoerper, trim54.S antikoerper, trim54 antikoerper, Trim54 antikoerper

Hintergrund: TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles.

Molekulargewicht: 45 kDa (MW of target protein)