GTPBP10 Antikörper
-
- Target Alle GTPBP10 Antikörper anzeigen
- GTPBP10 (GTP-Binding Protein 10 (GTPBP10))
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GTPBP10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYS
- Top Product
- Discover our top product GTPBP10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GTPBP10 Blocking Peptide, catalog no. 33R-2052, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GTPBP10 (GTP-Binding Protein 10 (GTPBP10))
- Andere Bezeichnung
- GTPBP10 (GTPBP10 Produkte)
- Hintergrund
- Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.
- Molekulargewicht
- 43 kDa (MW of target protein)
-