HPRT1 Antikörper
-
- Target Alle HPRT1 Antikörper anzeigen
- HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HPRT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HPRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK
- Top Product
- Discover our top product HPRT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HPRT1 Blocking Peptide, catalog no. 33R-8866, is also available for use as a blocking control in assays to test for specificity of this HPRT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPRT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))
- Andere Bezeichnung
- HPRT1 (HPRT1 Produkte)
- Hintergrund
- HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-