HPRT1 Antikörper

Produktnummer ABIN630595

Produktdetails anti-HPRT1 Antikörper

Target: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HPRT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HPRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HPRT1 Blocking Peptide, catalog no. 33R-8866, is also available for use as a blocking control in assays to test for specificity of this HPRT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPRT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HPRT1

Target: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Andere Bezeichnung: HPRT1 (HPRT1 Produkte)

Synonyme: HGPRT antikoerper, HPRT antikoerper, C81579 antikoerper, HPGRT antikoerper, Hprt1 antikoerper, Hgprtase antikoerper, Hprt antikoerper, id:ibd1344 antikoerper, id:ibd5108 antikoerper, wu:fc10g09 antikoerper, zgc:56221 antikoerper, zgc:86608 antikoerper, hgprt antikoerper, hprt antikoerper, prtfdc1 antikoerper, hprt1 antikoerper, hprt1l antikoerper, zgc:55561 antikoerper, zgc:86771 antikoerper, hypoxanthine phosphoribosyltransferase 1 antikoerper, hypoxanthine guanine phosphoribosyl transferase antikoerper, hypoxanthine phosphoribosyltransferase 1 L homeolog antikoerper, phosphoribosyl transferase domain containing 1 antikoerper, HPRT1 antikoerper, Hprt antikoerper, Hprt1 antikoerper, hprt1 antikoerper, hprt1.L antikoerper, prtfdc1 antikoerper

Hintergrund: HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process