CMAS Antikörper (N-Term)

Produktnummer ABIN630605

Produktdetails anti-CMAS Antikörper

Target: CMAS (Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CMAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CMAS antibody was raised against the N terminal of CMAS

Aufreinigung: Affinity purified

Immunogen: CMAS antibody was raised using the N terminal of CMAS corresponding to a region with amino acids GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CMAS Blocking Peptide, catalog no. 33R-3531, is also available for use as a blocking control in assays to test for specificity of this CMAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CMAS

Target: CMAS (Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS))

Andere Bezeichnung: CMAS (CMAS Produkte)

Synonyme: CSS antikoerper, cmas antikoerper, cmas1 antikoerper, si:dkey-183c2.1 antikoerper, wu:fj16c12 antikoerper, zgc:136241 antikoerper, AW208911 antikoerper, CMPNeu5Ac antikoerper, D6Bwg0250e antikoerper, cytidine monophosphate N-acetylneuraminic acid synthetase antikoerper, cytidine monophosphate N-acetylneuraminic acid synthetase a antikoerper, cytidine monophospho-N-acetylneuraminic acid synthetase antikoerper, CMAS antikoerper, Cmas antikoerper, cmasa antikoerper, cmas antikoerper

Hintergrund: CMAS is an enzyme that catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.

Molekulargewicht: 48 kDa (MW of target protein)