GAPDH Antikörper (Middle Region)

Produktnummer ABIN630606

Produktdetails anti-GAPDH Antikörper

Target: GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAPDH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GAPDH antibody was raised against the middle region of GAPDH

Aufreinigung: Affinity purified

Immunogen: GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAPDH Blocking Peptide, catalog no. 33R-4241, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-GAPDH Antikörper (ABIN630606)

Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." in: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." in: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

Details zu GAPDH

Target: GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Andere Bezeichnung: GAPDH (GAPDH Produkte)

Synonyme: G3PD antikoerper, GAPD antikoerper, Gapd antikoerper, BEST:GH12586 antikoerper, CG12055 antikoerper, Dmel\\CG12055 antikoerper, GA3PDH antikoerper, GADPH antikoerper, GAP antikoerper, GAPDH antikoerper, GAPDH I antikoerper, GAPDH-1 antikoerper, GAPDH1 antikoerper, GAPDHI antikoerper, Gapdh antikoerper, Gapdh-1 antikoerper, Gapdh43E antikoerper, gadph antikoerper, gapdh antikoerper, gapdh-1 antikoerper, gh12586 antikoerper, cb609 antikoerper, gapd antikoerper, mg:bb02e05 antikoerper, wu:fb33a10 antikoerper, wu:ft80f05 antikoerper, KNC-NDS6 antikoerper, g3pd antikoerper, G3PDH antikoerper, glyceraldehyde-3-phosphate dehydrogenase antikoerper, Glyceraldehyde 3 phosphate dehydrogenase 1 antikoerper, glyceraldehyde-3-phosphate dehydrogenase S homeolog antikoerper, glyceraldehyde-3-phosphate dehydrogenase, type I antikoerper, olfactory receptor 8K3 antikoerper, GAPDH antikoerper, Gapdh antikoerper, Gapdh1 antikoerper, gapdh antikoerper, gapdh.S antikoerper, gapDH antikoerper, LOC100404960 antikoerper, LOC614985 antikoerper

Hintergrund: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).

Molekulargewicht: 36 kDa (MW of target protein)