NASP Antikörper
-
- Target Alle NASP Antikörper anzeigen
- NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NASP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV
- Top Product
- Discover our top product NASP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NASP Blocking Peptide, catalog no. 33R-4313, is also available for use as a blocking control in assays to test for specificity of this NASP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NASP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))
- Andere Bezeichnung
- NASP (NASP Produkte)
- Synonyme
- FLB7527 antikoerper, PRO1999 antikoerper, 5033430J04Rik antikoerper, AI131596 antikoerper, AI317140 antikoerper, D4Ertd767e antikoerper, Epcs32 antikoerper, Nasp-T antikoerper, wu:fd20g12 antikoerper, zgc:56007 antikoerper, zgc:85651 antikoerper, nuclear autoantigenic sperm protein antikoerper, nuclear autoantigenic sperm protein (histone-binding) antikoerper, NASP antikoerper, Nasp antikoerper, nasp antikoerper
- Hintergrund
- This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene.
- Molekulargewicht
- 49 kDa (MW of target protein)
-