WDR77 Antikörper (N-Term)

Produktnummer ABIN630615

Produktdetails anti-WDR77 Antikörper

Target: WDR77 (WD Repeat Domain 77 (WDR77))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR77 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR77 antibody was raised against the N terminal of WDR77

Aufreinigung: Affinity purified

Immunogen: WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR77 Blocking Peptide, catalog no. 33R-6364, is also available for use as a blocking control in assays to test for specificity of this WDR77 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR77 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR77

Target: WDR77 (WD Repeat Domain 77 (WDR77))

Andere Bezeichnung: WDR77 (WDR77 Produkte)

Synonyme: MEP-50 antikoerper, MEP50 antikoerper, Nbla10071 antikoerper, RP11-552M11.3 antikoerper, p44 antikoerper, p44/Mep50 antikoerper, 2610003I18Rik antikoerper, 2610312E17Rik antikoerper, C79984 antikoerper, p44/MEP50 antikoerper, RGD1310479 antikoerper, mep50 antikoerper, valois antikoerper, WDR77 antikoerper, zgc:65780 antikoerper, zgc:77274 antikoerper, WD repeat domain 77 antikoerper, WD repeat domain 77 S homeolog antikoerper, WDR77 antikoerper, Wdr77 antikoerper, wdr77.S antikoerper, wdr77 antikoerper

Hintergrund: WDR77 is the non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. WDR77 might play a role in transcription regulation.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization