PIP5KL1 Antikörper (Middle Region)
-
- Target Alle PIP5KL1 Antikörper anzeigen
- PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIP5KL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PIP5 KL1 antibody was raised against the middle region of PIP5 L1
- Aufreinigung
- Affinity purified
- Immunogen
- PIP5 KL1 antibody was raised using the middle region of PIP5 L1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP
- Top Product
- Discover our top product PIP5KL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIP5KL1 Blocking Peptide, catalog no. 33R-9646, is also available for use as a blocking control in assays to test for specificity of this PIP5KL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 L1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))
- Andere Bezeichnung
- PIP5KL1 (PIP5KL1 Produkte)
- Synonyme
- PIPKH antikoerper, bA203J24.5 antikoerper, BC028795 antikoerper, phosphatidylinositol-4-phosphate 5-kinase like 1 antikoerper, phosphatidylinositol-4-phosphate 5-kinase-like 1 antikoerper, PIP5KL1 antikoerper, Pip5kl1 antikoerper
- Hintergrund
- PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-