STRADA Antikörper (N-Term)
-
- Target Alle STRADA Antikörper anzeigen
- STRADA (STE20-Related Kinase Adaptor alpha (STRADA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STRADA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LYK5 antibody was raised against the N terminal of LYK5
- Aufreinigung
- Affinity purified
- Immunogen
- LYK5 antibody was raised using the N terminal of LYK5 corresponding to a region with amino acids MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL
- Top Product
- Discover our top product STRADA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LYK5 Blocking Peptide, catalog no. 33R-6420, is also available for use as a blocking control in assays to test for specificity of this LYK5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYK5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STRADA (STE20-Related Kinase Adaptor alpha (STRADA))
- Andere Bezeichnung
- LYK5 (STRADA Produkte)
- Synonyme
- fj99g05 antikoerper, zgc:56109 antikoerper, wu:fj99g05 antikoerper, lyk5 antikoerper, LYK5 antikoerper, NY-BR-96 antikoerper, PMSE antikoerper, STRAD antikoerper, Stlk antikoerper, Lyk5 antikoerper, 2610019A05Rik antikoerper, 6030402H20Rik antikoerper, AI480680 antikoerper, E130112C09Rik antikoerper, STE20-related kinase adaptor alpha antikoerper, ste20-related kinase adaptor alpha antikoerper, STRADA antikoerper, strada antikoerper, Strada antikoerper
- Hintergrund
- LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- AMPK Signaling
-