PNMA3 Antikörper (N-Term)
-
- Target Alle PNMA3 Antikörper anzeigen
- PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PNMA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PNMA3 antibody was raised against the N terminal of PNMA3
- Aufreinigung
- Affinity purified
- Immunogen
- PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM
- Top Product
- Discover our top product PNMA3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PNMA3 Blocking Peptide, catalog no. 33R-7501, is also available for use as a blocking control in assays to test for specificity of this PNMA3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))
- Andere Bezeichnung
- PNMA3 (PNMA3 Produkte)
- Hintergrund
- This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.
- Molekulargewicht
- 52 kDa (MW of target protein)
-