SMC2 Antikörper (N-Term)

Produktnummer ABIN630626

Produktdetails anti-SMC2 Antikörper

Target: SMC2 (Structural Maintenance of Chromosomes 2 (SMC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SMC2 antibody was raised against the N terminal of SMC2

Aufreinigung: Affinity purified

Immunogen: SMC2 antibody was raised using the N terminal of SMC2 corresponding to a region with amino acids ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMC2 Blocking Peptide, catalog no. 33R-4161, is also available for use as a blocking control in assays to test for specificity of this SMC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMC2

Target: SMC2 (Structural Maintenance of Chromosomes 2 (SMC2))

Andere Bezeichnung: SMC2 (SMC2 Produkte)

Synonyme: CAP-E antikoerper, CAPE antikoerper, SMC-2 antikoerper, SMC2L1 antikoerper, 5730502P04Rik antikoerper, AI255214 antikoerper, AW545314 antikoerper, Fin16 antikoerper, Smc2l1 antikoerper, fb92e05 antikoerper, wu:fb92e05 antikoerper, zeh1628 antikoerper, zgc:55326 antikoerper, xcap-e antikoerper, SCII antikoerper, structural maintenance of chromosomes 2 antikoerper, structural maintenance of chromosomes 2 L homeolog antikoerper, SMC2 antikoerper, Smc2 antikoerper, smc2 antikoerper, smc2.L antikoerper

Hintergrund: SMC2 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Molekulargewicht: 32 kDa (MW of target protein)