IMPDH1 Antikörper
-
- Target Alle IMPDH1 Antikörper anzeigen
- IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IMPDH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE
- Top Product
- Discover our top product IMPDH1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IMPDH1 Blocking Peptide, catalog no. 33R-4468, is also available for use as a blocking control in assays to test for specificity of this IMPDH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))
- Andere Bezeichnung
- IMPDH1 (IMPDH1 Produkte)
- Synonyme
- IMPD antikoerper, IMPD1 antikoerper, LCA11 antikoerper, RP10 antikoerper, sWSS2608 antikoerper, B930086D20Rik antikoerper, IMPD 1 antikoerper, IMPDH 1 antikoerper, D3 antikoerper, IMPD 1b antikoerper, IMPDH 1b antikoerper, IMPDH1 antikoerper, id:ibd5035 antikoerper, si:dkey-31f5.7 antikoerper, wu:fa09h11 antikoerper, wu:fa99c03 antikoerper, zgc:113446 antikoerper, imp antikoerper, imp1 antikoerper, imp2 antikoerper, IMPD 1a antikoerper, IMPDH 1a antikoerper, zgc:91911 antikoerper, inosine monophosphate dehydrogenase 1 antikoerper, inosine-5'-monophosphate dehydrogenase 1 antikoerper, IMP (inosine 5'-monophosphate) dehydrogenase 1b antikoerper, IMP (inosine 5'-monophosphate) dehydrogenase 1 antikoerper, IMP (inosine 5'-monophosphate) dehydrogenase 1a antikoerper, IMPDH1 antikoerper, Impdh1 antikoerper, LOC100442769 antikoerper, impdh1 antikoerper, impdh1b antikoerper, impdh1.L antikoerper, impdh1a antikoerper
- Hintergrund
- IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-