VASH1 Antikörper (N-Term)
-
- Target Alle VASH1 Antikörper anzeigen
- VASH1 (Vasohibin 1 (VASH1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VASH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Vasohibin 1 antibody was raised against the N terminal of VASH1
- Aufreinigung
- Affinity purified
- Immunogen
- Vasohibin 1 antibody was raised using the N terminal of VASH1 corresponding to a region with amino acids ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER
- Top Product
- Discover our top product VASH1 Primärantikörper
-
anti-Vasohibin 1 (VASH1) (AA 3-100) antibody
VASH1 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 4A3 unconjugated
anti-Vasohibin 1 (VASH1) (AA 1-204) antibodyVASH1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Vasohibin 1 (VASH1) (AA 281-365) antibodyVASH1 Reaktivität: Human, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Vasohibin 1 (VASH1) (Internal Region) antibodyVASH1 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Vasohibin 1 (VASH1) (AA 3-100) antibodyVASH1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Vasohibin 1 (VASH1) (AA 1-204) antibodyVASH1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Vasohibin 1 (VASH1) (AA 3-101) antibodyVASH1 Reaktivität: Human WB, ELISA, IHC, IHC (p) Wirt: Maus Monoclonal 4A3 unconjugated
anti-Vasohibin 1 (VASH1) (AA 1-365) antibodyVASH1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Vasohibin 1 (VASH1) (AA 108-157) antibodyVASH1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Affe, Schwein, Hamster, Xenopus laevis, Fledermaus, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Vasohibin 1 (VASH1) (AA 72-121) antibodyVASH1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Affe, Schwein, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Vasohibin 1 Blocking Peptide, catalog no. 33R-1576, is also available for use as a blocking control in assays to test for specificity of this Vasohibin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VASH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VASH1 (Vasohibin 1 (VASH1))
- Andere Bezeichnung
- Vasohibin 1 (VASH1 Produkte)
- Synonyme
- KIAA1036 antikoerper, AI834978 antikoerper, D930046M13Rik antikoerper, G630009D10Rik antikoerper, RGD1564082 antikoerper, vasohibin 1 antikoerper, VASH1 antikoerper, vash1 antikoerper, Vash1 antikoerper
- Hintergrund
- VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration.
- Molekulargewicht
- 41 kDa (MW of target protein)
-
