ASF1B Antikörper

Produktnummer ABIN630638

Produktdetails anti-ASF1B Antikörper

Target: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASF1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ASF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASF1B Blocking Peptide, catalog no. 33R-10123, is also available for use as a blocking control in assays to test for specificity of this ASF1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASF1B

Target: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Andere Bezeichnung: ASF1B (ASF1B Produkte)

Hintergrund: ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Regulation of Cell Size