QTRTD1 Antikörper (N-Term)

Produktnummer ABIN630639

Produktdetails anti-QTRTD1 Antikörper

Target: QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser QTRTD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: QTRTD1 antibody was raised against the N terminal of QTRTD1

Aufreinigung: Affinity purified

Immunogen: QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

QTRTD1 Blocking Peptide, catalog no. 33R-10263, is also available for use as a blocking control in assays to test for specificity of this QTRTD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRTD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu QTRTD1

Target: QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))

Andere Bezeichnung: QTRTD1 (QTRTD1 Produkte)

Synonyme: 3110012M05Rik antikoerper, 4930470H18Rik antikoerper, AI648807 antikoerper, queuine tRNA-ribosyltransferase accessory subunit 2 antikoerper, queuine tRNA-ribosyltransferase accessory subunit 2 L homeolog antikoerper, QTRT2 antikoerper, qtrt2 antikoerper, qtrt2.L antikoerper, Qtrt2 antikoerper

Hintergrund: QTRTD1 belongs to the queuine tRNA-ribosyltransferase family. The function of the QTRTD1 protein remains unknown.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process