QTRTD1 Antikörper (N-Term)
-
- Target Alle QTRTD1 Antikörper anzeigen
- QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser QTRTD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- QTRTD1 antibody was raised against the N terminal of QTRTD1
- Aufreinigung
- Affinity purified
- Immunogen
- QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI
- Top Product
- Discover our top product QTRTD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
QTRTD1 Blocking Peptide, catalog no. 33R-10263, is also available for use as a blocking control in assays to test for specificity of this QTRTD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRTD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))
- Andere Bezeichnung
- QTRTD1 (QTRTD1 Produkte)
- Hintergrund
- QTRTD1 belongs to the queuine tRNA-ribosyltransferase family. The function of the QTRTD1 protein remains unknown.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-