STRAP Antikörper (N-Term)
-
- Target Alle STRAP Antikörper anzeigen
- STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STRAP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- STRAP antibody was raised against the N terminal of STRAP
- Aufreinigung
- Affinity purified
- Immunogen
- STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL
- Top Product
- Discover our top product STRAP Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STRAP Blocking Peptide, catalog no. 33R-3756, is also available for use as a blocking control in assays to test for specificity of this STRAP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRAP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))
- Andere Bezeichnung
- STRAP (STRAP Produkte)
- Hintergrund
- The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.
- Molekulargewicht
- 38 kDa (MW of target protein)
-