STRAP Antikörper (N-Term)

Produktnummer ABIN630640

Produktdetails anti-STRAP Antikörper

Target: STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STRAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: STRAP antibody was raised against the N terminal of STRAP

Aufreinigung: Affinity purified

Immunogen: STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STRAP Blocking Peptide, catalog no. 33R-3756, is also available for use as a blocking control in assays to test for specificity of this STRAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRAP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STRAP

Target: STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))

Andere Bezeichnung: STRAP (STRAP Produkte)

Synonyme: MAWD antikoerper, PT-WD antikoerper, UNRIP antikoerper, zgc:56677 antikoerper, zgc:77604 antikoerper, mawd antikoerper, pt-wd antikoerper, unrip antikoerper, AW557906 antikoerper, C78091 antikoerper, C79202 antikoerper, Unrip antikoerper, serine/threonine kinase receptor associated protein antikoerper, tetratricopeptide repeat domain 5 antikoerper, serine/threonine kinase receptor associated protein L homeolog antikoerper, serine/threonine kinase receptor associated protein S homeolog antikoerper, STRAP antikoerper, TTC5 antikoerper, strap antikoerper, strap.L antikoerper, strap.S antikoerper, Strap antikoerper

Hintergrund: The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.

Molekulargewicht: 38 kDa (MW of target protein)