CK1 epsilon Antikörper (N-Term)
-
- Target Alle CK1 epsilon (CSNK1E) Antikörper anzeigen
- CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CK1 epsilon Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CK1 epsilon antibody was raised against the N terminal of CSNK1 E
- Aufreinigung
- Affinity purified
- Immunogen
- CK1 epsilon antibody was raised using the N terminal of CSNK1 E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH
- Top Product
- Discover our top product CSNK1E Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CK1 epsilon Blocking Peptide, catalog no. 33R-5936, is also available for use as a blocking control in assays to test for specificity of this CK1 epsilon antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))
- Andere Bezeichnung
- CK1 epsilon (CSNK1E Produkte)
- Synonyme
- CKIepsilon antikoerper, HCKIE antikoerper, CKIe antikoerper, ck1-epsilon antikoerper, ck1epsilon antikoerper, hckie antikoerper, dco antikoerper, fj38c01 antikoerper, wu:fj38c01 antikoerper, wu:fj62a04 antikoerper, zgc:77310 antikoerper, AI426939 antikoerper, AI551861 antikoerper, AW457082 antikoerper, CK1epsilon antikoerper, KC1epsilon antikoerper, tau antikoerper, ckie antikoerper, CSNK1E antikoerper, Csnk1e antikoerper, CKI-epsilon antikoerper, 0538/13 antikoerper, 0915/10 antikoerper, 1396/02 antikoerper, 1447/01 antikoerper, 1460/09 antikoerper, CG2048 antikoerper, CK1delta/epsilon antikoerper, DBT antikoerper, DBT/CK1epsilon antikoerper, DCO antikoerper, DCO/CKIe antikoerper, Dbt antikoerper, Dco antikoerper, Dco/CK1 antikoerper, Dmel\CG2048 antikoerper, dCKIepsilon antikoerper, dbt antikoerper, dco-1 antikoerper, ddbt antikoerper, l(3)S053813 antikoerper, l(3)S144701 antikoerper, l(3)dco antikoerper, l(3)dco-1 antikoerper, l(3)discs overgrown antikoerper, l(3)discs overgrown-1 antikoerper, l(3)j3B9 antikoerper, l(3)rK215 antikoerper, casein kinase 1 epsilon antikoerper, casein kinase 1, epsilon antikoerper, casein kinase 1 epsilon L homeolog antikoerper, casein kinase I isoform epsilon antikoerper, casein kinase I epsilon antikoerper, casein kinase I antikoerper, LOC400927-CSNK1E readthrough antikoerper, discs overgrown antikoerper, CSNK1E antikoerper, csnk1e antikoerper, Csnk1e antikoerper, csnk1e.L antikoerper, LOC443240 antikoerper, NAEGRDRAFT_82890 antikoerper, LOC100407384 antikoerper, LOC100523244 antikoerper, LOC100607246 antikoerper, LOC100727500 antikoerper, LOC400927-CSNK1E antikoerper, dco antikoerper
- Hintergrund
- Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg, M Phase
-