CK1 epsilon Antikörper (N-Term)

Produktnummer ABIN630641

Produktdetails anti-CK1 epsilon Antikörper

Target: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CK1 epsilon Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CK1 epsilon antibody was raised against the N terminal of CSNK1 E

Aufreinigung: Affinity purified

Immunogen: CK1 epsilon antibody was raised using the N terminal of CSNK1 E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CK1 epsilon Blocking Peptide, catalog no. 33R-5936, is also available for use as a blocking control in assays to test for specificity of this CK1 epsilon antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CK1 epsilon

Target: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Andere Bezeichnung: CK1 epsilon (CSNK1E Produkte)

Hintergrund: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Hedgehog Signalweg, M Phase