TRIB2 Antikörper

Produktnummer ABIN630642

Produktdetails anti-TRIB2 Antikörper

Target: TRIB2 (Tribbles Pseudokinase 2 (TRIB2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TRIB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIB2 Blocking Peptide, catalog no. 33R-10196, is also available for use as a blocking control in assays to test for specificity of this TRIB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIB2

Target: TRIB2 (Tribbles Pseudokinase 2 (TRIB2))

Andere Bezeichnung: TRIB2 (TRIB2 Produkte)

Synonyme: TRIB2 antikoerper, Trb2 antikoerper, Xtrbl antikoerper, gs3955 antikoerper, c5fw antikoerper, trb2 antikoerper, xtrb2 antikoerper, TRB2 antikoerper, C5FW antikoerper, GS3955 antikoerper, TRB-2 antikoerper, AW319517 antikoerper, RGD1564451 antikoerper, tribbles pseudokinase 2 antikoerper, tribbles pseudokinase 2 S homeolog antikoerper, TRIB2 antikoerper, trib2 antikoerper, trib2.S antikoerper, Trib2 antikoerper

Hintergrund: TRIB2 is one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia.

Molekulargewicht: 39 kDa (MW of target protein)