Raly Antikörper (N-Term)
-
- Target Alle Raly (RALY) Antikörper anzeigen
- Raly (RALY) (RNA-binding protein Raly (RALY))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Raly Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RALY antibody was raised against the N terminal of RALY
- Aufreinigung
- Affinity purified
- Immunogen
- RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ
- Top Product
- Discover our top product RALY Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RALY Blocking Peptide, catalog no. 33R-6745, is also available for use as a blocking control in assays to test for specificity of this RALY antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALY antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Raly (RALY) (RNA-binding protein Raly (RALY))
- Andere Bezeichnung
- RALY (RALY Produkte)
- Synonyme
- AI663842 antikoerper, Merc antikoerper, HNRPCL2 antikoerper, P542 antikoerper, zgc:103445 antikoerper, hnRNP-associated with lethal yellow antikoerper, RALY heterogeneous nuclear ribonucleoprotein antikoerper, Raly antikoerper, RALY antikoerper, raly antikoerper
- Hintergrund
- In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family.
- Molekulargewicht
- 30 kDa (MW of target protein)
-