HIPK1 Antikörper (Middle Region)
-
- Target Alle HIPK1 Antikörper anzeigen
- HIPK1 (Homeodomain Interacting Protein Kinase 1 (HIPK1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HIPK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HIPK1 antibody was raised against the middle region of HIPK1
- Aufreinigung
- Affinity purified
- Immunogen
- HIPK1 antibody was raised using the middle region of HIPK1 corresponding to a region with amino acids PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
- Top Product
- Discover our top product HIPK1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HIPK1 Blocking Peptide, catalog no. 33R-7200, is also available for use as a blocking control in assays to test for specificity of this HIPK1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HIPK1 (Homeodomain Interacting Protein Kinase 1 (HIPK1))
- Andere Bezeichnung
- HIPK1 (HIPK1 Produkte)
- Synonyme
- HIPK1 antikoerper, myak antikoerper, nbak2 antikoerper, hipk1 antikoerper, Myak antikoerper, Nbak2 antikoerper, 1110062K04Rik antikoerper, homeodomain interacting protein kinase 1 antikoerper, homeodomain interacting protein kinase 1 L homeolog antikoerper, homeodomain interacting protein kinase 1 S homeolog antikoerper, HIPK1 antikoerper, hipk1.L antikoerper, hipk1 antikoerper, hipk1.S antikoerper, Hipk1 antikoerper
- Hintergrund
- HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.
- Molekulargewicht
- 131 kDa (MW of target protein)
-