TSSK2 Antikörper (Middle Region)

Produktnummer ABIN630656

Produktdetails anti-TSSK2 Antikörper

Target: TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSSK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TSSK2 antibody was raised against the middle region of TSSK2

Aufreinigung: Affinity purified

Immunogen: TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSSK2 Blocking Peptide, catalog no. 33R-8066, is also available for use as a blocking control in assays to test for specificity of this TSSK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSSK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSSK2

Target: TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))

Andere Bezeichnung: TSSK2 (TSSK2 Produkte)

Synonyme: DGS-G antikoerper, SPOGA2 antikoerper, STK22B antikoerper, TSK2 antikoerper, Stk22b antikoerper, Tsk2 antikoerper, TSSK2 antikoerper, testis specific serine kinase 2 antikoerper, testis-specific serine kinase 2 antikoerper, testis-specific serine/threonine-protein kinase 2 antikoerper, TSSK2 antikoerper, Tssk2 antikoerper, LOC486426 antikoerper, LOC100471688 antikoerper

Hintergrund: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis.

Molekulargewicht: 39 kDa (MW of target protein)