MAP3K15 Antikörper (Middle Region)
-
- Target Alle MAP3K15 Antikörper anzeigen
- MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAP3K15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAP3 K15 antibody was raised against the middle region of MAP3 15
- Aufreinigung
- Affinity purified
- Immunogen
- MAP3 K15 antibody was raised using the middle region of MAP3 15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT
- Top Product
- Discover our top product MAP3K15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAP3K15 Blocking Peptide, catalog no. 33R-9170, is also available for use as a blocking control in assays to test for specificity of this MAP3K15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))
- Andere Bezeichnung
- MAP3K15 (MAP3K15 Produkte)
- Synonyme
- MCO15.4 antikoerper, MCO15_4 antikoerper, mitogen-activated protein kinase kinase kinase 15 antikoerper, ASK3 antikoerper, bA723P2.3 antikoerper, BC031147 antikoerper, MEKK15 antikoerper, mitogen-activated protein kinase kinase kinase 15 antikoerper, MAPKKK15 antikoerper, MAP3K15 antikoerper, Map3k15 antikoerper
- Hintergrund
- MAP3K15 is a component of a protein kinase signal transduction cascade.
- Molekulargewicht
- 89 kDa (MW of target protein)
-