SMUG1 Antikörper (Middle Region)
-
- Target Alle SMUG1 Antikörper anzeigen
- SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SMUG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SMUG1 antibody was raised against the middle region of SMUG1
- Aufreinigung
- Affinity purified
- Immunogen
- SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC
- Top Product
- Discover our top product SMUG1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SMUG1 Blocking Peptide, catalog no. 33R-4200, is also available for use as a blocking control in assays to test for specificity of this SMUG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMUG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))
- Andere Bezeichnung
- SMUG1 (SMUG1 Produkte)
- Synonyme
- SMUG1 antikoerper, xsmug1 antikoerper, 1200013B09Rik antikoerper, A930006H09Rik antikoerper, C85220 antikoerper, FDG antikoerper, HMUDG antikoerper, UNG3 antikoerper, single-strand-selective monofunctional uracil-DNA glycosylase 1 antikoerper, single-strand selective monofunctional uracil DNA glycosylase antikoerper, single-strand-selective monofunctional uracil-DNA glycosylase 1 L homeolog antikoerper, SMUG1 antikoerper, smug1 antikoerper, smuG1 antikoerper, smuG antikoerper, LOC5577584 antikoerper, CpipJ_CPIJ002767 antikoerper, Smug1 antikoerper, smug1.L antikoerper
- Hintergrund
- SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.
- Molekulargewicht
- 30 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-