ING3 Antikörper (N-Term)

Produktnummer ABIN630670

Produktdetails anti-ING3 Antikörper

Target: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ING3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ING3 antibody was raised against the N terminal of ING3

Aufreinigung: Affinity purified

Immunogen: ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ING3 Blocking Peptide, catalog no. 33R-5862, is also available for use as a blocking control in assays to test for specificity of this ING3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ING3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ING3

Target: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Andere Bezeichnung: ING3 (ING3 Produkte)

Synonyme: ING3 antikoerper, Eaf4 antikoerper, ING2 antikoerper, MEAF4 antikoerper, p47ING3 antikoerper, 1300013A07Rik antikoerper, P47ING3 antikoerper, zgc:56327 antikoerper, inhibitor of growth family member 3 antikoerper, inhibitor of growth family, member 3 antikoerper, inhibitor of growth protein 3 antikoerper, inhibitor of growth family member 3 L homeolog antikoerper, ING3 antikoerper, Ing3 antikoerper, CpipJ_CPIJ009396 antikoerper, ing3 antikoerper, ing3.L antikoerper

Hintergrund: ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.

Molekulargewicht: 47 kDa (MW of target protein)