RNF20 Antikörper (N-Term)

Produktnummer ABIN630671

Produktdetails anti-RNF20 Antikörper

Target: RNF20 (Ring Finger Protein 20 (RNF20))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF20 antibody was raised against the N terminal of RNF20

Aufreinigung: Affinity purified

Immunogen: RNF20 antibody was raised using the N terminal of RNF20 corresponding to a region with amino acids LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF20 Blocking Peptide, catalog no. 33R-5103, is also available for use as a blocking control in assays to test for specificity of this RNF20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF20

Target: RNF20 (Ring Finger Protein 20 (RNF20))

Andere Bezeichnung: RNF20 (RNF20 Produkte)

Synonyme: 4833430L21Rik antikoerper, AW540162 antikoerper, C79397 antikoerper, mKIAA4116 antikoerper, BRE1 antikoerper, BRE1A antikoerper, hBRE1 antikoerper, ring finger protein 20 antikoerper, RNF20 antikoerper, Rnf20 antikoerper

Hintergrund: RNF20 shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is an ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3.

Molekulargewicht: 114 kDa (MW of target protein)