PIM1 Antikörper (N-Term)
-
- Target Alle PIM1 Antikörper anzeigen
- PIM1 (Pim-1 Oncogene (PIM1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PIM1 antibody was raised against the N terminal of PIM1
- Aufreinigung
- Affinity purified
- Immunogen
- PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
- Top Product
- Discover our top product PIM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIM1 Blocking Peptide, catalog no. 33R-6196, is also available for use as a blocking control in assays to test for specificity of this PIM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIM1 (Pim-1 Oncogene (PIM1))
- Andere Bezeichnung
- PIM1 (PIM1 Produkte)
- Synonyme
- PIM antikoerper, Pim-1 antikoerper, PIM1 antikoerper, pim antikoerper, pim-1 antikoerper, pim3 antikoerper, Pim-1 proto-oncogene, serine/threonine kinase antikoerper, proviral integration site 1 antikoerper, Pim-1 proto-oncogene, serine/threonine kinase L homeolog antikoerper, PIM1 antikoerper, Pim1 antikoerper, pim1 antikoerper, pim1.L antikoerper
- Hintergrund
- PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-