PIN4 Antikörper (N-Term)

Produktnummer ABIN630679

Produktdetails anti-PIN4 Antikörper

Target: PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIN4 antibody was raised against the N terminal of PIN4

Aufreinigung: Affinity purified

Immunogen: PIN4 antibody was raised using the N terminal of PIN4 corresponding to a region with amino acids MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIN4 Blocking Peptide, catalog no. 33R-6296, is also available for use as a blocking control in assays to test for specificity of this PIN4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIN4

Target: PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))

Andere Bezeichnung: PIN4 (PIN4 Produkte)

Synonyme: 2410002I22Rik antikoerper, EPVH antikoerper, Par14 antikoerper, PAR14 antikoerper, PAR17 antikoerper, zgc:110008 antikoerper, peptidylprolyl cis/trans isomerase, NIMA-interacting 4 antikoerper, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) antikoerper, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) antikoerper, PIN4 antikoerper, Pin4 antikoerper, pin4 antikoerper

Hintergrund: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle and chromatin remodeling.

Molekulargewicht: 16 kDa (MW of target protein)