Trmt11 Antikörper
-
- Target Alle Trmt11 Antikörper anzeigen
- Trmt11 (tRNA Methyltransferase 11 Homolog (Trmt11))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Trmt11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TRMT11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP
- Top Product
- Discover our top product Trmt11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRMT11 Blocking Peptide, catalog no. 33R-4021, is also available for use as a blocking control in assays to test for specificity of this TRMT11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMT11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Trmt11 (tRNA Methyltransferase 11 Homolog (Trmt11))
- Andere Bezeichnung
- TRMT11 (Trmt11 Produkte)
- Synonyme
- 2410075D05Rik antikoerper, 3110045I18Rik antikoerper, AW213713 antikoerper, Mds024 antikoerper, MDS024 antikoerper, C6orf75 antikoerper, TRM11 antikoerper, TRMT11-1 antikoerper, tRNA methyltransferase 11 antikoerper, tRNA methyltransferase 11 homolog antikoerper, tRNA methyltransferase 11 homolog L homeolog antikoerper, Trmt11 antikoerper, trmt11.L antikoerper, TRMT11 antikoerper
- Hintergrund
- TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.
- Molekulargewicht
- 53 kDa (MW of target protein)
-