H2AFY Antikörper (N-Term)
-
- Target Alle H2AFY Antikörper anzeigen
- H2AFY (H2A Histone Family, Member Y (H2AFY))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser H2AFY Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- H2 AFY antibody was raised against the N terminal of H2 FY
- Aufreinigung
- Affinity purified
- Immunogen
- H2 AFY antibody was raised using the N terminal of H2 FY corresponding to a region with amino acids HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV
- Top Product
- Discover our top product H2AFY Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
H2AFY Blocking Peptide, catalog no. 33R-3812, is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- H2AFY (H2A Histone Family, Member Y (H2AFY))
- Andere Bezeichnung
- H2AFY (H2AFY Produkte)
- Hintergrund
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Molekulargewicht
- 39 kDa (MW of target protein)
-