TTC5 Antikörper (C-Term)
-
- Target Alle TTC5 Antikörper anzeigen
- TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TTC5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TTC5 antibody was raised against the C terminal of TTC5
- Aufreinigung
- Affinity purified
- Immunogen
- TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV
- Top Product
- Discover our top product TTC5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TTC5 Blocking Peptide, catalog no. 33R-3213, is also available for use as a blocking control in assays to test for specificity of this TTC5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))
- Andere Bezeichnung
- TTC5 (TTC5 Produkte)
- Synonyme
- TTC5 antikoerper, ttc5 antikoerper, wu:fi33h05 antikoerper, wu:fy81e07 antikoerper, zgc:112059 antikoerper, Strap antikoerper, 5930437N14 antikoerper, AW743060 antikoerper, tetratricopeptide repeat domain 5 L homeolog antikoerper, tetratricopeptide repeat domain 5 antikoerper, ttc5.L antikoerper, TTC5 antikoerper, ttc5 antikoerper, Ttc5 antikoerper
- Hintergrund
- TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-