GAPVD1 Antikörper (N-Term)

Produktnummer ABIN630695

Produktdetails anti-GAPVD1 Antikörper

Target: GAPVD1 (GTPase Activating Protein and VPS9 Domains 1 (GAPVD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAPVD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: GAPVD1 antibody was raised against the N terminal of GAPVD1

Aufreinigung: Affinity purified

Immunogen: GAPVD1 antibody was raised using the N terminal of GAPVD1 corresponding to a region with amino acids FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAPVD1 Blocking Peptide, catalog no. 33R-2950, is also available for use as a blocking control in assays to test for specificity of this GAPVD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPVD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAPVD1

Target: GAPVD1 (GTPase Activating Protein and VPS9 Domains 1 (GAPVD1))

Andere Bezeichnung: GAPVD1 (GAPVD1 Produkte)

Synonyme: zgc:92666 antikoerper, GAPEX5 antikoerper, RAP6 antikoerper, 2010005B09Rik antikoerper, 4432404J10Rik antikoerper, AW108497 antikoerper, Gapex-5 antikoerper, RME-6 antikoerper, mKIAA1521 antikoerper, RGD1307479 antikoerper, GTPase activating protein and VPS9 domains 1 antikoerper, GTPase activating protein and VPS9 domains 1 S homeolog antikoerper, LOAG_00609 antikoerper, GAPVD1 antikoerper, gapvd1 antikoerper, gapvd1.S antikoerper, Gapvd1 antikoerper

Hintergrund: GAPVD1 acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor internalization or LC2A4/GLUT4 trafficking. It acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. It is also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitination and subsequent degradation by the proteasome. It has GEF activity for Rab5 and GAP activity for Ras.

Molekulargewicht: 166 kDa (MW of target protein)