TUBA3C Antikörper (N-Term)

Produktnummer ABIN630696

Produktdetails anti-TUBA3C Antikörper

Target: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBA3C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Alpha Tubulin 3 C antibody was raised against the N terminal of TUBA3

Aufreinigung: Affinity purified

Immunogen: alpha Tubulin 3 C antibody was raised using the N terminal of TUBA3 corresponding to a region with amino acids QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

alpha Tubulin 3C Blocking Peptide, catalog no. 33R-7656, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 3C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBA3C

Target: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Abstract: TUBA3C Produkte

Synonyme: TUBA2 antikoerper, bA408E5.3 antikoerper, TUBA1A antikoerper, TUBA3 antikoerper, TUBA3C antikoerper, TUBA3D antikoerper, 3t antikoerper, ALPHA 84D antikoerper, CG2512 antikoerper, D.m.ALPHA-84D antikoerper, DTA4 antikoerper, Dmel\CG2512 antikoerper, T antikoerper, Tub antikoerper, Tub1A antikoerper, aTub84D antikoerper, alpha-Tub antikoerper, alpha-Tub84D antikoerper, alpha-tub antikoerper, alpha-tub84D antikoerper, alpha-tubulin antikoerper, alpha3 antikoerper, alpha3t antikoerper, alpha84D antikoerper, alphaTUB antikoerper, alphaTUB84D antikoerper, alphaTub antikoerper, alphaTub3 antikoerper, alphaTub84 antikoerper, tuba2 antikoerper, tuba3c antikoerper, tuba3d antikoerper, GRMZM2G153292 antikoerper, TUA2 antikoerper, zgc:73108 antikoerper, tubulin alpha 3c antikoerper, tubulin, alpha 3A antikoerper, tubulin alpha like 3 antikoerper, tubulin alpha-1B chain antikoerper, tubulin alpha-1A chain antikoerper, alpha-Tubulin at 84D antikoerper, tubulin alpha 3c S homeolog antikoerper, tubulin alpha-2 chain-like antikoerper, tubulin, alpha 2 antikoerper, TUBA3C antikoerper, Tuba3a antikoerper, TUBAL3 antikoerper, LOC610636 antikoerper, LOC782966 antikoerper, alphaTub84D antikoerper, tuba3c.S antikoerper, LOC103643947 antikoerper, tuba2 antikoerper

Hintergrund: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics