RBBP7 Antikörper (N-Term)

Produktnummer ABIN630697

Produktdetails anti-RBBP7 Antikörper

Target: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBBP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBBP7 antibody was raised against the N terminal of RBBP7

Aufreinigung: Affinity purified

Immunogen: RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBBP7 Blocking Peptide, catalog no. 33R-6545, is also available for use as a blocking control in assays to test for specificity of this RBBP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBBP7

Target: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Andere Bezeichnung: RBBP7 (RBBP7 Produkte)

Synonyme: RbAp46 antikoerper, AA409861 antikoerper, AI173248 antikoerper, AU019541 antikoerper, BB114024 antikoerper, mRbAp46 antikoerper, rbap46 antikoerper, RBBP7 antikoerper, RBBP-7 antikoerper, Caf1 antikoerper, rbbp7 antikoerper, wu:fa13g08 antikoerper, wu:fb50h10 antikoerper, wu:fc29d09 antikoerper, zgc:56477 antikoerper, zgc:85617 antikoerper, CaO19.2146 antikoerper, RB binding protein 7, chromatin remodeling factor antikoerper, retinoblastoma binding protein 7, chromatin remodeling factor antikoerper, retinoblastoma binding protein 7 L homeolog antikoerper, retinoblastoma binding protein 7 antikoerper, retinoblastoma binding protein 4, like antikoerper, histone-binding protein RBBP7 antikoerper, Hat2p antikoerper, RBBP7 antikoerper, Rbbp7 antikoerper, rbbp7.L antikoerper, rbbp7 antikoerper, rbb4l antikoerper, LOC108708306 antikoerper, HAT2 antikoerper

Hintergrund: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation.

Molekulargewicht: 48 kDa (MW of target protein)