NUP155 Antikörper (Middle Region)

Produktnummer ABIN630700

Produktdetails anti-NUP155 Antikörper

Target: NUP155 (Nucleoporin 155kDa (NUP155))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUP155 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NUP155 antibody was raised against the middle region of NUP155

Aufreinigung: Affinity purified

Immunogen: NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUP155 Blocking Peptide, catalog no. 33R-4155, is also available for use as a blocking control in assays to test for specificity of this NUP155 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP155 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUP155

Target: NUP155 (Nucleoporin 155kDa (NUP155))

Andere Bezeichnung: NUP155 (NUP155 Produkte)

Hintergrund: Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.

Molekulargewicht: 147 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus