HERC4 Antikörper (N-Term)
-
- Target Alle HERC4 Antikörper anzeigen
- HERC4 (Hect Domain and RLD 4 (HERC4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HERC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HERC4 antibody was raised against the n terminal of HERC4
- Aufreinigung
- Affinity purified
- Immunogen
- HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL
- Top Product
- Discover our top product HERC4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HERC4 Blocking Peptide, catalog no. 33R-6183, is also available for use as a blocking control in assays to test for specificity of this HERC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HERC4 (Hect Domain and RLD 4 (HERC4))
- Andere Bezeichnung
- HERC4 (HERC4 Produkte)
- Synonyme
- 1700056O17Rik antikoerper, 4921531D01Rik antikoerper, 9530080M15Rik antikoerper, mKIAA1593 antikoerper, HECT and RLD domain containing E3 ubiquitin protein ligase 4 antikoerper, HECT and RLD domain containing E3 ubiquitin protein ligase 4 S homeolog antikoerper, hect domain and RLD 4 antikoerper, HERC4 antikoerper, herc4 antikoerper, herc4.S antikoerper, Herc4 antikoerper
- Hintergrund
- HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.
- Molekulargewicht
- 13 kDa (MW of target protein)
-