FBXL3 Antikörper (Middle Region)
-
- Target Alle FBXL3 Antikörper anzeigen
- FBXL3 (F-Box and Leucine-Rich Repeat Protein 3 (FBXL3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXL3 antibody was raised against the middle region of FBXL3
- Aufreinigung
- Affinity purified
- Immunogen
- FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV
- Top Product
- Discover our top product FBXL3 Primärantikörper
-
anti-F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) (AA 1-100) antibody
FBXL3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1A3 unconjugated
anti-F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) antibodyFBXL3 Reaktivität: Human WB, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) (N-Term) antibodyVerified FBXL3 Reaktivität: Human WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) (AA 1-292) antibodyFBXL3 Reaktivität: Maus WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) (AA 1-100) antibodyFBXL3 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) (AA 144-193) antibodyFBXL3 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Zebrafisch (Danio rerio), Pferd, Kaninchen, Schaf, Schwein, Affe, Fledermaus, Xenopus laevis, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) (AA 239-288) antibodyFBXL3 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Zebrafisch (Danio rerio), Pferd, Kaninchen, Schaf, Schwein, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXL3 Blocking Peptide, catalog no. 33R-5067, is also available for use as a blocking control in assays to test for specificity of this FBXL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXL3 (F-Box and Leucine-Rich Repeat Protein 3 (FBXL3))
- Andere Bezeichnung
- FBXL3 (FBXL3 Produkte)
- Hintergrund
- FBXL3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Photoperiodism
-
