MKRN2 Antikörper (N-Term)
-
- Target Alle MKRN2 Antikörper anzeigen
- MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MKRN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MKRN2 antibody was raised against the N terminal of MKRN2
- Aufreinigung
- Affinity purified
- Immunogen
- MKRN2 antibody was raised using the N terminal of MKRN2 corresponding to a region with amino acids STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRC
- Top Product
- Discover our top product MKRN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MKRN2 Blocking Peptide, catalog no. 33R-8870, is also available for use as a blocking control in assays to test for specificity of this MKRN2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))
- Andere Bezeichnung
- MKRN2 (MKRN2 Produkte)
- Synonyme
- MKRN2 antikoerper, RNF62 antikoerper, MGC131105 antikoerper, mkrn2 antikoerper, Makorin-2 antikoerper, hspc070 antikoerper, wu:fb99a04 antikoerper, 2610002L04Rik antikoerper, C81377 antikoerper, makorin ring finger protein 2 antikoerper, makorin ring finger protein 2 pseudogene antikoerper, makorin ring finger protein 2 L homeolog antikoerper, makorin-2 antikoerper, makorin, ring finger protein, 2 antikoerper, MKRN2 antikoerper, LOC100401355 antikoerper, mkrn2 antikoerper, mkrn2.L antikoerper, Mkrn2 antikoerper
- Hintergrund
- Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.
- Molekulargewicht
- 47 kDa (MW of target protein)
-