MKRN2 Antikörper (C-Term)

Produktnummer ABIN630704

Produktdetails anti-MKRN2 Antikörper

Target: MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MKRN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MKRN2 antibody was raised against the C terminal of MKRN2

Aufreinigung: Affinity purified

Immunogen: MKRN2 antibody was raised using the C terminal of MKRN2 corresponding to a region with amino acids ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MKRN2 Blocking Peptide, catalog no. 33R-1071, is also available for use as a blocking control in assays to test for specificity of this MKRN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MKRN2

Target: MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Andere Bezeichnung: MKRN2 (MKRN2 Produkte)

Synonyme: MKRN2 antikoerper, RNF62 antikoerper, MGC131105 antikoerper, mkrn2 antikoerper, Makorin-2 antikoerper, hspc070 antikoerper, wu:fb99a04 antikoerper, 2610002L04Rik antikoerper, C81377 antikoerper, makorin ring finger protein 2 antikoerper, makorin ring finger protein 2 pseudogene antikoerper, makorin ring finger protein 2 L homeolog antikoerper, makorin-2 antikoerper, makorin, ring finger protein, 2 antikoerper, MKRN2 antikoerper, LOC100401355 antikoerper, mkrn2 antikoerper, mkrn2.L antikoerper, Mkrn2 antikoerper

Hintergrund: Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.

Molekulargewicht: 47 kDa (MW of target protein)