Deoxyuridine Triphosphatase (DUT) (N-Term) Antikörper
-
- Target Alle Deoxyuridine Triphosphatase (DUT) Antikörper anzeigen
- Deoxyuridine Triphosphatase (DUT)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DUT antibody was raised against the N terminal of DUT
- Aufreinigung
- Affinity purified
- Immunogen
- DUT antibody was raised using the N terminal of DUT corresponding to a region with amino acids AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPK
- Top Product
- Discover our top product DUT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DUT Blocking Peptide, catalog no. 33R-1060, is also available for use as a blocking control in assays to test for specificity of this DUT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Deoxyuridine Triphosphatase (DUT)
- Andere Bezeichnung
- DUT (DUT Produkte)
- Substanzklasse
- Viral Protein
- Hintergrund
- DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.
- Molekulargewicht
- 19 kDa (MW of target protein)
-