Deoxyuridine Triphosphatase (DUT) (N-Term) Antikörper

Produktnummer ABIN630705

Produktdetails

Target: Deoxyuridine Triphosphatase (DUT)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DUT antibody was raised against the N terminal of DUT

Aufreinigung: Affinity purified

Immunogen: DUT antibody was raised using the N terminal of DUT corresponding to a region with amino acids AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DUT Blocking Peptide, catalog no. 33R-1060, is also available for use as a blocking control in assays to test for specificity of this DUT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Deoxyuridine Triphosphatase (DUT)

Andere Bezeichnung: DUT (DUT Produkte)

Synonyme: BcDNA:LD08534 antikoerper, CG4584 antikoerper, Dmel\\CG4584 antikoerper, LD08534 antikoerper, UTPase antikoerper, anon-SAGE:Wang-077 antikoerper, dUTPase antikoerper, Tb07.27E10.390 antikoerper, dutpase antikoerper, 5031412I06Rik antikoerper, 5133400F09Rik antikoerper, D2Bwg0749e antikoerper, Dutp antikoerper, PIP4 antikoerper, deoxyuridine triphosphatase antikoerper, Deoxyuridine triphosphatase antikoerper, dUTPase; ORF54; similar to EBV BLLF3, CMV UL72, HSV UL50 antikoerper, involved in nucleotide metabolism antikoerper, tegument protein antikoerper, dUTPase antikoerper, deoxyuridine triphosphatase L homeolog antikoerper, DUT antikoerper, dUTPase antikoerper, P18 antikoerper, AlHV1gp51 antikoerper, UL50 antikoerper, HVT058 antikoerper, ORF9 antikoerper, ORF8 antikoerper, U45 antikoerper, GAMMAHV.ORF54 antikoerper, Tc00.1047053509151.130 antikoerper, Tc00.1047053508175.160 antikoerper, Tb927.7.5160 antikoerper, dut.L antikoerper, Dut antikoerper

Substanzklasse: Viral Protein

Hintergrund: DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.

Molekulargewicht: 19 kDa (MW of target protein)