TUBA3C Antikörper (N-Term)

Produktnummer ABIN630708

Produktdetails anti-TUBA3C Antikörper

Target: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBA3C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Alpha Tubulin 3 C antibody was raised against the N terminal of TUBA3

Aufreinigung: Affinity purified

Immunogen: alpha Tubulin 3 C antibody was raised using the N terminal of TUBA3 corresponding to a region with amino acids VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

alpha Tubulin 3C Blocking Peptide, catalog no. 33R-9469, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 3C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBA3C

Target: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Abstract: TUBA3C Produkte

Hintergrund: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics